PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2BS_E8D2BD66E.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 332aa    MW: 36360.9 Da    PI: 5.4074
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2BS_E8D2BD66E.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.74.9e-172673148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           rg+WT eEd ll+++++  G g+W++ ar+ g++Rt+k+c++rw++yl
  Traes_2BS_E8D2BD66E.1 26 RGPWTVEEDVLLANYIAANGEGRWNALARRAGLKRTGKSCRLRWLNYL 73
                           89********************************************97 PP

2Myb_DNA-binding51.62.2e-1679122146
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                            rg +T+eE++l +++++++G++ W++Ia++++ gRt++++k++w++
  Traes_2BS_E8D2BD66E.1  79 RGGMTAEEQLLVLELHARWGNR-WSKIAQHLP-GRTDNEIKNYWRT 122
                            6789******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.7892173IPR017930Myb domain
SuperFamilySSF466891.09E-2825120IPR009057Homeodomain-like
SMARTSM007172.4E-142575IPR001005SANT/Myb domain
PfamPF002498.7E-162673IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.4E-212780IPR009057Homeodomain-like
CDDcd001672.01E-102873No hitNo description
PROSITE profilePS5129423.28974128IPR017930Myb domain
SMARTSM007177.9E-1578126IPR001005SANT/Myb domain
PfamPF002493.4E-1579122IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-2281127IPR009057Homeodomain-like
CDDcd001678.78E-1282122No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MAYDQRGLRG EEAAAAAVGE EEMLRRGPWT VEEDVLLANY IAANGEGRWN ALARRAGLKR  60
TGKSCRLRWL NYLRPDLRRG GMTAEEQLLV LELHARWGNR WSKIAQHLPG RTDNEIKNYW  120
RTRVQRHAKQ LRCDVGSQRF RDLVRGLWIP RLLERIHAAA NNSGDGDVIA QATAAALPVA  180
ADGRCWPVDD VFDLGPGAAA DVELSCTTAL SSSSSVSTDG CGVLQPLPAP APMVATAESA  240
RGSVIISAAM HDTALWQPPQ THGGLMMTQE QQHHQQAESQ PQLLGAETWW SDQTSLPAGL  300
YADVGFPELE FGGETMWGAC ADDLWCTDML GL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C1e-24231261103C-Myb DNA-Binding Domain
1msf_C1e-24231261103C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3686900.0AK368690.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2078D05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004958743.15e-98PREDICTED: myb-related protein 330-like
TrEMBLW5BPP60.0W5BPP6_WHEAT; Uncharacterized protein
STRINGSi030584m2e-97(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48000.13e-74myb domain protein 112
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]